HENMT1 Antibody NBP1-88330 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

HENMT1 Antibody

Western Blot: HENMT1 Antibody [NBP1-88330] - Analysis in control (vector only transfected HEK293T lysate) and HENMT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
HENMT1 Antibody

HENMT1 Antibody
HENMT1 Antibody

Western Blot: HENMT1 Antibody [NBP1-88330] - Analysis in control (vector only transfected HEK293T lysate) and HENMT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
HENMT1 Antibody

Western Blot: HENMT1 Antibody [NBP1-88330] - Analysis in control (vector only transfected HEK293T lysate) and HENMT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
HENMT1 Antibody

Western Blot: HENMT1 Antibody [NBP1-88330] - Analysis in control (vector only transfected HEK293T lysate) and HENMT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
HENMT1 Antibody

Product Specs
ItemHENMT1 Antibody
CompanyNovus Biologicals, a Bio-Techne Brand
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberNBP1-88330
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetHENMT1
HostRabbit
NCBI Gene AliasesC1orf59, HEN1
ApplicationsWestern Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Quantity0.1 ml (also 25ul)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: MEENNLQCSS VVDGNFEEVP RETAIQFKPP LYRQRYQFVK NLVDQHEPKK VADLGCGDTS LLRLLKVNPC IELLVGV
Conjugate/TagUnconjugated
NCBI Full Gene NameHEN methyltransferase 1
Brand/TrademarkNovus Biologicals, a Bio-Techne Brand
IsotypeIgG
ClonalityPolyclonal
PurityImmunogen affinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Sequence

MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: http://www.novusbio.com

Be the First to Write a Review!